PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g06130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 434aa    MW: 48342.1 Da    PI: 7.0017
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g06130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.73.1e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ ++  g++R++k+c++rw +yl
   Vang05g06130.1 15 KGPWTPEEDNILVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-25665IPR009057Homeodomain-like
PROSITE profilePS5129424.9231066IPR017930Myb domain
SMARTSM007171.0E-151464IPR001005SANT/Myb domain
PfamPF002491.4E-171562IPR001005SANT/Myb domain
SuperFamilySSF466895.59E-241689IPR009057Homeodomain-like
CDDcd001671.99E-121762No hitNo description
PROSITE profilePS500904.0196389IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-86689IPR009057Homeodomain-like
SMARTSM007176967119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MMGRAPCSDE SGLKKGPWTP EEDNILVDYI QKHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEQQLII NLHAVLGNNL QQLLTATNIF TNTLDINALR LQSDATELAK  120
LQLLHNMLQV LVASPASNLD LLNPFGSSLP DEILGLDQSK LQNLYNSSTG FLSQNQSNFF  180
QSFEAPPQQQ ALPTGYNHMN GGSNRSCMKS EKVDEQLDVP YSFSTALDSL PNLVSATPEC  240
SSGKQMENMV NPNEFSDPSS TSTTFEMLGD FMYEEVTDAY WKDLIENSCL VPMKLKMDSS  300
LYKVWVAGVR LPPLCFNCDV SSRTALAVIF SKGSRCGLPE FTSSIVLQPR RQLDNRHCSS  360
ISPPQASLGL ISLAVYRLPL SRLHSRELLF VVWYRDSCAS KGQFSNIAVY AVLYEPHLFH  420
QTCVINAHCS TKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-171393584B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523159.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0S3SEJ20.0A0A0S3SEJ2_PHAAN; Uncharacterized protein
STRINGGLYMA12G01960.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.27e-63myb domain protein 9